PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 346aa    MW: 39966.8 Da    PI: 6.2901
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602844.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.8e-5381371129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv++yL+kk++++++++ +vik++d+yk+ePwdL++  ++ +ee+ +wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_009602844.1   8 VPPGFRFHPTDEELVDYYLRKKITSRRIDV-DVIKDIDLYKIEPWDLQElcRMGTEEQsDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAI 101
                     69****************************.9***************954555554445************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +s k+ l+g++ktLv+ykgrap+g+k+d +mheyrle
  XP_009602844.1 102 YS-KHDLIGMRKTLVYYKGRAPNGQKSDFIMHEYRLE 137
                     **.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-585157IPR003441NAC domain
PROSITE profilePS5100556.838157IPR003441NAC domain
PfamPF023653.9E-279136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MMNSFSQVPP GFRFHPTDEE LVDYYLRKKI TSRRIDVDVI KDIDLYKIEP WDLQELCRMG  60
TEEQSDWYFF SHKDKKYPTG TRTNRATAAG FWKATGRDKA IYSKHDLIGM RKTLVYYKGR  120
APNGQKSDFI MHEYRLETDP NGAPQDEGWV ICRVFKKKIA AMRMDTSEHG SPIWYDDQLS  180
FMPDNMDSPK PPYPHSTITT YNNHYPNYPN CKKELDNLHY QIPPHQQFLQ LPLLETNSKL  240
LAAAPSGISC SSMPIFGINV NQEHLHPTFG NNINRGCTND QVEDQVTDWR VLDKFVASQL  300
SQEDENNYSN ARGDDSNLMV KVLDKQEMAP ENTSTASSSS QIDLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-48815815169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-101HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602844.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_016456031.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-134NAC7_ARATH; NAC domain-containing protein 7
TrEMBLK4C4Q50.0K4C4Q5_SOLLC; Uncharacterized protein
STRINGSolyc06g034340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-108NAC 007